SKU: 96615560908

IgG4 Fc Protein, Human

Sale price$117.00 Regular price$130.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 13 - Jul 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IgG4 Fc Protein, HumanProduct Specification Species Human Synonyms IgG4 Fc; Human IgG4 Fc protein, Ig gamma 4 chain C region, IgG4 Fc Accession P01861 Amino Acid Sequence ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK Expression System HEK293 Molecular Weight 30 32 KDa(Reducing) Purity 95%, by

Product Specification


Species Human
Synonyms IgG4 Fc;Human IgG4 Fc protein, Ig gamma-4 chain C region, IgG4 Fc
Accession P01861
Amino Acid Sequence ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
Expression System HEK293
Molecular Weight 30-32 KDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4, 5% trehalose
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G4 (IgG4), one of the four human IgG subtypes, is a monomer immunoglobulin mainly involved in secondary antibody reaction, which is produced and secreted by B cells. The IgG tetramer consists of two heavy chains (50 kDa) and two light chains (25 kDa) connected by disulfide bonds, which are two identical halves to form a Y shape. After pepsin cleavage, IgG was divided into two F (ab) s with one antigen binding site and a highly conserved Fc segment. The Fc segment has a highly conserved n-glycosylation site. IgG4 is the least common IgG among healthy adults, accounting for about 5% of the total IgG library. Although the amino acid sequence of IgG4 is about 90% homologous to other IgG subclasses, IgG4 is unique because it is a univalent function with little or no inflammation, and IgG4 Fc can bind to other Fc from all human IgG subclasses. IgG4 is generally considered to be a protective blocking antibody because it can inhibit or prevent inflammation by binding to inflammatory IgG subclasses or IgE competitive antigens. In addition, IgG4 can cause a subset of autoimmune diseases in severe diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 96615560908

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1742 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Anne
Cuba, US
★★★★★ 5
Winner !!!
Color: Orange
This amazed us. For perspective, we're talking about a three year old white german shepherd who if he's in the mood, has and can kill a toy within minutes or oddly enough be gentle with furry balls and carry them around as if they are his babies. He's an odd duck. Anyway, since he was a pup, and to this day, he'll play and entertain himself, he'll grab a ball, throw it up in the air, then pounce on it as if it's from outer space. It's really quite cute and funny. Because of those two things I was looking for something interactive that would entertain him and confuse him....let's be honest, watching a confused dog is one of life's great pleasures. I tried two other interactive balls and they were crushed immediately. After reading a lot of reviews, people with german shepherds said this ball actually had a life span. I thought the third time could be the charm and ordered one. Well, I think it actually may be from outer space because he's obsessed with it and hasn't taken a bite out of it. He hasn't once chewed it or even teared little pieces off. The three settings are great. Sometimes he likes one better than another, then forgets about the others. I'll change it up to one he hasn't seen in a while and the whole game starts over again. He'll throw it up in the air as he does with his others, watch it and try to figure out which way it's going to go. And yes, he will pounce on it if he times it right. The size is perfect, it's heavier than your average ball but, that's what make it sturdy. I have to sneak it away when he isn't paying attention to charge it, otherwise he'll sit, stare and cry if he knows it's on the counter charging. It's a lot of fun for all of us. I'm so happy I bought it...... I say give this ball a chance even if you have a beast with killer instincts. I'm buying another for a friends 2 year old golden retriever granddog. Thank you Cheerble.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
C
Verified Purchase
Cascadian
New York, US
★★★★★ 5
Great For Dog Park Fun -- The Ball Goes Flying
Size: 25in, Style: Sport
I love this thing. It's super well made and It enables me to chuck a ball the entire length of the dog park (I'm a 65 yr old woman with a wimpy arm). My dog is thrilled too. At first I thought it might be too heavy, but that's just not an issue, the weight is fine. For non-throwers like me someone at the dog park gave me a tip --- just look at the area you want to throw the ball. Helped my aim immensely. The 2.5 inch chuck it ball it comes with is my dog's absolute *favorite* . . . it's her security blanket in the kennel while driving, and it's her favorite ball to chase (the only one she'll actually bring back). She loves to chew it and to squish the air out of it, which takes a little effort. Recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2025
L
Verified Purchase
leal536
Alexandria, US
★★★★★ 5
Great tool!
Size: 18in, Style: Sport
Ok - so I do not have a dog!!! I purchased this item for a completely different purpose! I saw someone using this to gather eggs!! I often go to my daughter and son-in-law's homestead to carry out the chores when they need to be out of town! Well, I am a bit on the short side (4'11") and some of the hens KNOW that a short person is going to be gathering eggs!!! I simply could not reach all of the eggs in a couple of the nesting boxes! So, after seeing someone else use this ball launcher as an egg retriever, I bought one! I am now able to reach ALL of the eggs - one at a time with no breakage! It was a game changer for me. I am sure that it works equally well for dog play!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 15, 2024
S
Verified Purchase
Steven
Port Orchard, US
★★★★★ 5
A Fun and Engaging Playtime Essential for Active Dogs
Size: 18in, Style: Sport
The ChuckIt! Sport 18M Dog Ball Launcher has been a game-changer in our playtime routine with our energetic and playful dog. This innovative and well-designed ball launcher has become an essential tool to keep our furry friend entertained and active. The 18" length of the launcher provides a comfortable grip for both me and my dog during play. It allows for effortless throwing, making fetch games enjoyable for both of us. The launcher's ergonomic design ensures a smooth and efficient ball-throwing experience, saving me from straining my arm during extended play sessions. The inclusion of a medium-sized ball (2.5") with the launcher is a thoughtful addition. The ball's size and weight are perfect for our medium-sized dog (20-60 pounds), allowing her to easily grab and carry it in her mouth. The ball is also durable and can withstand the enthusiastic chewing of our playful pup. One of the standout features of the ChuckIt! Sport 18M Dog Ball Launcher is its exceptional throwing distance. It allows us to launch the ball far into the distance, providing ample space for our dog to run and fetch. This extended range adds a fun and challenging element to our playtime, keeping our dog engaged and excited. The durable construction of the launcher is commendable. It has proven to withstand rigorous use and outdoor play, making it a reliable and long-lasting investment for our dog's entertainment. Additionally, the launcher's compatibility with other ChuckIt! balls makes it a versatile tool for various play styles and preferences. Whether it's a bouncy rubber ball or a flying disc, the launcher can handle them all. Moreover, using the ChuckIt! Sport 18M Dog Ball Launcher has strengthened the bond between our family and our dog. It encourages interactive play, providing an opportunity for us to engage and connect with our furry companion while promoting exercise and healthy physical activity. In conclusion, the ChuckIt! Sport 18M Dog Ball Launcher has been an absolute joy for our family and our playful dog. Its easy-to-use design, impressive throwing distance, and durability make it a must-have for any dog owner with an active and fetch-loving pet. We highly recommend the ChuckIt! Sport 18M Dog Ball Launcher, along with the included medium ball, for a fun-filled and active playtime experience that both you and your dog will love.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2023
A
Verified Purchase
Another Floyd
Port Orchard, US
★★★★★ 5
Essential kit for those with fetch dogs
Size: 18in, Style: Sport
Now in our 3rd year, my Brittany and I are down to about 40 fetch tosses a day, some 14,600 tosses a year. The Chuck It launcher wears well, so, figure at least 5 years of use, for 73,000 tosses. That makes for a terrific value! There are several key benefits of the Chuck It launchers: One is that you can chuck the ball further than you can throw, which allows you to exercise your dog more easily. The second is that you can pick up and launch the ball without touching it, which means NO slime! And, the Chuck It also gives extra reach when you have to retrieve a ball from sticker brambles. Those are great features for anyone with a fetch dog. If you also happen to have a weak arm or shoulder, the Chuck It launchers provide nice throwing options. I generally throw underhanded. I can't get the full potential range, that way, but, I still get good, long tosses. I curl my second finger above the last bump on the handle, and use a good wrist flick along with arm swing. I've seen others throw side-arm with the Chuck It. I had originally written a second review for the longer 25M Chuck It. Either I, or Amazon messed up, and it looks like I can have only this one review. So, here are my additional thoughts on the 25M: I bought the 25M so that I could throw the ball even further! The good news is, you really can chuck further, with the longer chucker. The bad news is, those longer throws do require more arm and shoulder strength than when using the 18M. This becomes more obvious when you've done 3 or 4 dozen throws. I would recommend the 25M only for those with the youth and/or strength to get the most out of it. Otherwise, I'd say, go with the 18M.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2016

recommand products