SKU: 86101970480

Mouse CD95, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 20 - Jul 25

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD95, his tagProduct Specification Species Mouse Synonyms Apo 1 antigen, Apoptosis mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6 Accession P25446 Amino Acid Sequence Protein sequence (P25446, Gln22 Arg169, with C 10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 2 kDa

Product Specification


Species Mouse
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen FAS, FASLG receptor, Apt1, Tnfrsf6
Accession P25446
Amino Acid Sequence

Protein sequence (P25446, Gln22-Arg169, with C-10*His) QGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQPGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQNTKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 23-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86101970480

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BobbiJo- SpicyBookswBB
Alexandria, US
★★★★★ 5
So good!
Format: Kindle
Wings of Stars was a fantastic first book to a new series. It grabbed me in its clutches within the first chapter and kept ahold of me. This new world of M Sinclair and RL Caulder’s is all about angels and mythical creatures. It’s full of drama from all points. From Kieran’s awful home life to keeping the stars alive and everything in between. Kieran is our FMC and despite everything she keeps her spirit and defiance. Keeping to their norm, there is a group of guys for our FMC but they definitely aren’t established yet, and not fully cemented yet into being a group rather than her choosing between them. Ronan is so sweet and gives off Daddy vibes Gabe is also sweet and wants the best of everything for Kieran and will defend her against anyone Bastian is slightly unhinged but I loved him immediately Steele is a jerk… just as you find redeeming qualities, he screws up again… but yet I still want him to redeem himself. There’s another one… but if I gave his name I would be spoiling a plot twist so you will just have to find out yourself… but you’ll love him as much as I do. This is a slow burn but the little bit of spice we do get is hot, especially with the dirty talk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2024
G
Verified Purchase
Gabby C.
Omaha, US
★★★★★ 5
Angels and the Fallen — Breathtaking Start
Format: Kindle
This book was EVERYTHING I expected it to be and more. Leave to R.L. Caulder and M. Sinclair to give us yet another amazing book! Kieran and her guys hooked me from the very beginning and did not let go. Found family is one of my favorite tropes and it was done so well in this book. Couple that along with an FMC trying to find her place in the world and I was practically drooling over this book. The world building, the conflict, the wyverin sidekick — it all was done so well that it felt fresh and real. Each love interest felt real and unique in their own ways. I felt connected to each one and like they were truly different people. I love that so much in a book and these two authors never miss with their love interests. Multi POV, Reverse harem, who did this to you, and a magical world highlighting the angels and the fallen. This book has everything and it does it so well. Big thank you to R.L. Caulder and M. Sinclair for the arc copy! I cannot wait for book 2!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2024
C
Verified Purchase
Chrystal
Dallas, US
★★★★★ 4
A new take 🤔
Format: Kindle
I’m not going to go into what this book is about — by now you e already read the synopsis and have an idea — but I will give a couple of insights. Definitely a different take on angels and their fall; I like it. This is an interesting start to a new series - YES, this does end on a cliffhanger so be prepared for that. I’m eager for the next book (and hopefully the last in this series — sometimes the author(s) will switch it up depending on how the story flows for them) in this series. I’m hoping that a certain male character redeems himself because he’s a dick that will make the meaning of mixed signals jealous lol. You ever watch that old movie — I think it’s call Mommy Dearest? — yea, let’s switch that up to daddy. That man would make a perfect husband to mommy dearest. I recommend this book because while these authors are well known for their cliffhangers, they are also well known for putting out good stories.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2024
M
Verified Purchase
M Weidner
Natrona Heights, US
★★★★★ 3
Liked it
Format: Kindle
I liked the worlds and the characters. The prophesy is confusing in that I would think, since all worlds ore on a path to destruction, the angels would want their world to be saved. I am sure there is more evil that will be revealed as the series proceeds. I dislike a prolonged “poor little me” trope and the main character has moved past that, thankfully, and began to show a fierce attitude as the novel progressed. The last portion of the novel had some great action. It’s worth reading, just be patient with a slow start.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 14, 2024
D
Verified Purchase
Darcie Reads A Lot
West Palm Beach, US
★★★★★ 5
Unexpectedly emotional and packed with action!
Format: Kindle
Why do I suddenly want nothing more than a tiny wyvern to snuggle with?! It’s adorable and I absolutely love all of those moments! Wings of Stars was everything I’ve come expect from this powerful author duo. The fact that it’s written by two different people is completely transparent to the reader and they’ve brought us another world and characters that we’re all emotionally connected to and fully invested in! The injustice that we see from Alfemir in the many forms in which it comes is infuriating and makes me desperate for the conclusion of the story so they can all get what’s coming to them! I love all the guys right now, with one exception, and if you’re read it, you know exactly who I’m talking about. Bastian is hilarious - he was the comedic relief through an otherwise quite serious story. My heart bleeds for him and I can’t wait to see how he progresses through the series. Parts of Wings of Stars were unexpectedly emotional and of course I was left with my jaw on the floor at that cliffhanger! Next, please!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025

recommand products