SKU: 84114699511

Human IL-13, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-13, His tagProduct Specification Species Human Synonyms NC30 Accession P35225 Amino Acid Sequence Protein sequence(P35225, Gly35 Asn146 with C 10*His) GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 14. 0 kDa Actual: 25 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU mg Tag with C 10*His Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms NC30
Accession P35225
Amino Acid Sequence

Protein sequence(P35225, Gly35-Asn146 with C-10*His) GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:14.0 kDa Actual:25-35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. IL-13 was first cloned in 1993 and is located on chromosome 5q31.1 with a length of 1.4kb. It has a mass of 13 kDa and folds into 4 alpha helical bundles. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence identity to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, natural killer T cell, mast cells, basophils, eosinophils and nuocytes. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 84114699511

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
A. Biscevic
Port Orchard, US
★★★★★ 5
Better than Shiseido for a fraction of the price
Size: 6 Fl Oz (Pack of 2), Style: Lotion
I bought this sunscreen for a trip to Florida but now it's my everyday sunscreen. My job includes driving around to body shops so my hands get a lot of sun, and I'm too embarrassed to wear driving gloves. I was using Shiseido's clear sunscreen stick (also SPF 50+) but had a slightly noticeable tan line at my wrist, both from my jacket and my watch so I wasn't sure if it was really working, despite the good reviews (and $$). This Banana Boat sunscreen feels so good that I decided to try it out for my hands every day, and it's fantastic. Smells good, not greasy at all it soaks right in, and the best part is my tan line is GONE. 10/10 please don't ever discontinue or change the formula.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
V
Verified Purchase
Valerie Berry
Battle Creek, US
★★★★★ 5
The best sunblock I've found!
Size: 6 Fl Oz (Pack of 2), Style: Lotion
I absolutely love this sunblock. I have sensory issues with any type of lotion and sunblock, but this stuff is incredible. It really is so lightweight that once it fully soaks in (which only take a few minutes) it feels as if there's nothing on my skin. This is huge for me, cause I just can't handle the feeling of any other sunblocks I've tried, even some more expensive brands. On top of all that, it definitely protects my skin from the sun, doesn't leave a white cast, and doesn't feel greasy while applying it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
R
Verified Purchase
Rudyinparis
Charlottesville, US
★★★★★ 4
My favorite sunscreen for being active outside
Size: 6 Fl Oz (Pack of 2), Style: Lotion
I bought this last summer and now it's my go-to. I love it. It absorbs quickly, is very easy to just smear on, and has a nice, very light scent. I wear it when I go running and I sweat like a maniac so that tells you something.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
S
Verified Purchase
Sarah C.
Fort Morgan, US
★★★★★ 5
Possibly the best sunscreen on the US market
Size: 6 Fl Oz (Pack of 2), Style: Lotion
I'm a self-confessed sunscreen snob. I love trying new formulas, and I came to the conclusion years ago that US formulas aren't usually for me. We haven't had a new filter approved by the FDA since the last millennium, and our products reflect that. I can't tell you how many times I spent $40+ on 1.7oz of sunscreen that I ended up hating before I switched to mostly Korean sunscreens; and most of the US sunscreens I like can be described as "good...for a US formula." In short, I didn't have high hopes for this, and I was very pleasantly surprised. This is a very, very good sunscreen even among non-US formulas. It's lightweight, doesn't make my oily skin shiny, and dries down entirely so it doesn't feel tacky or slimy. I can layer over and over throughout the day without pilling or streaks. It also comes in a huge tube for a very low price. The only possible downside is that it's fragranced, which isn't a deal breaker for me. I wish they still sold the 3oz facial version because it's travel-friendly, but from what I can tell, it's the same formula. Try this, especially if you hate thick, heavy, shiny sunscreens. Unless you can't do fragrance, I think you will be very happy with it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2025
A
Verified Purchase
Amanda S.
Fort Morgan, US
★★★★★ 5
Favorite Sunscreen!
Size: 6 Fl Oz (Pack of 2), Style: Lotion
We absolutely love this SPF. It’s been our go-to for years. It does not make your skin feel sticky or crunchy. It goes on so smooth (like air!) and absorbs so well. It feels like the softest moisturizer. And it works! We get the two pack every summer. It’s also kinda hard to find. Amazon always comes through! Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products